PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A12G2014
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 263aa    MW: 29534.8 Da    PI: 5.0351
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A12G2014genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding482.9e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l++ +   G  +W++ ++  g++R++k+c++rw +yl
      Gh_A12G2014 14 KGPWTAEEDQKLINFILTNGQCCWRALPKLAGLRRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding52.31.3e-1670111447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       ++ E++l +d++++lG++ W++Ia++++ gRt++++k++w+++
      Gh_A12G2014  70 LSEAEEQLVIDLHARLGNR-WSKIAARLP-GRTDNEIKNHWNTH 111
                      5899***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-20563IPR009057Homeodomain-like
PROSITE profilePS5129413.764961IPR017930Myb domain
SuperFamilySSF466891.1E-2611108IPR009057Homeodomain-like
SMARTSM007172.9E-121363IPR001005SANT/Myb domain
PfamPF002496.1E-141461IPR001005SANT/Myb domain
CDDcd001678.38E-91661No hitNo description
PROSITE profilePS5129427.32162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.7E-2564117IPR009057Homeodomain-like
SMARTSM007175.5E-1566114IPR001005SANT/Myb domain
PfamPF002495.7E-1570111IPR001005SANT/Myb domain
CDDcd001671.20E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MGRQPCCDKL GVKKGPWTAE EDQKLINFIL TNGQCCWRAL PKLAGLRRCG KSCRLRWTNY  60
LRPDLKRGLL SEAEEQLVID LHARLGNRWS KIAARLPGRT DNEIKNHWNT HIKKKLVKMG  120
IDPVTHEPLN KQSKTEQSPS HGHNSADNHI TENDGTAANS SEDNSSTTPT ENCSTTDDSI  180
LLDSICNDES LLTSLWLDEP PLADDSWNST VPAAETCNDQ TSLPSWEDSI AWLLDCQDFG  240
IHDFGFDCLN DNELNTTNTY TKQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-29141167108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012439548.10.0PREDICTED: protein ODORANT1-like
RefseqXP_012439547.10.0PREDICTED: protein ODORANT1-like
SwissprotQ50EX61e-107ODO1_PETHY; Protein ODORANT1
TrEMBLA0A0B0NZN50.0A0A0B0NZN5_G
STRINGPOPTR_0003s11360.11e-138(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12350.11e-107myb domain protein 42